Glyma19g31230 - SoyBase

SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g31230

Feature Type:	gene_model
Chromosome:	Gm19
Start:	38988596
stop:	38993100
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g31230

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G14800	AT	Annotation by Michelle Graham. TAIR10: pyrroline-5- carboxylate (P5C) reductase \| chr5:4786190-4787618 REVERSE LENGTH=276	SoyBase	E_val: 3.00E-155	ISS
GO:0006561	GO-bp	Annotation by Michelle Graham. GO Biological Process: proline biosynthetic process	SoyBase	N/A	ISS
GO:0006567	GO-bp	Annotation by Michelle Graham. GO Biological Process: threonine catabolic process	SoyBase	N/A	ISS
GO:0009408	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to heat	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005618	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell wall	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0004735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: pyrroline-5-carboxylate reductase activity	SoyBase	N/A	ISS
GO:0016491	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity	SoyBase	N/A	ISS
KOG3124	KOG	Pyrroline-5-carboxylate reductase	JGI		ISS
PTHR11645	Panther	PYRROLINE-5-CARBOXYLATE REDUCTASE	JGI		ISS
PF03807	PFAM	NADP oxidoreductase coenzyme F420-dependent	JGI		ISS
UniRef100_P17817	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Pyrroline-5-carboxylate reductase n=3 Tax=Glycine max RepID=P5CR_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_P17817	UniRef	Annotation by Michelle Graham. Best UniRef hit: Pyrroline-5-carboxylate reductase n=3 Tax=Glycine max RepID=P5CR_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma19g31230

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g31230

Paralog	Evidence	Comments
Glyma03g28476	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g31230 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g131500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g31230

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g31230

Limit To All Plant Sequences

>Glyma19g31230.1   sequence type=CDS   gene model=Glyma19g31230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAATCTTTCCGATTCCCGCCGAATCCTACACTCTCGGCTTCATCGGCGCCGGAAAAATGGCCGAGTCCATTGCCCGAGGCGCCGTCCGCTCCGGCGTCCTGCCGCCTTCTCGCATTCGGACCGCCGTCCACTTCAACCTCGCCCGCCGTGGCGCCTTCGAGTCCTTCGGCGTCACCGTTCTCCCTTCAAACGACGACGTCGTTCGCGAAAGCGACGTCGTCGTTTTGTCGGTCAAACCTCAATTAGTGAAAGACGTGGTGTCGAAATTGACGCCGCTTTTGACGAAGAACAAGCTTTTGGTTTCGGTCGCTGCTGGTACCAAATTGAAAGATCTTCAGGAATGGGCTGGGAACGACAGATTTATAAGAGTGATGCCTAATACCCCAGCAGCTGTTGGCCAGGCAGCATCTGTAATGAGCTTGGGGGGATCTGCAACGGAAGAAGATGGAAATATTATAGCCCAATTATTTGGGTCAATTGGCAAAATATGGAAAGCTGAGGAAAAGTATTTTGATGCAATAACTGGCCTGAGTGGCAGTGGTCCTGCTTATGTTTATTTAGCAATAGAGGCTTTGGCTGATGGAGGAGTAGCAGCTGGTTTACCACGTGATCTTTCATTAAGTCTAGCTTCTCAAACTGTATTAGGGGCAGCATCAATGGTCTCCCAGACTGGGAAGCACCCGGGACAGCTCAAAGATGACGTTACTTCTCCAGGTGGGACAACAATTACGGGCATTCATGAGTTAGAAAATGGTGGGTTCCGTGGAACACTGATGAATGCTGTTGTTGCTGCTGCTAAGCGCAGCCGAGAGCTTTCCTGA

Predicted protein sequences of Glyma19g31230

Limit To All Plant Sequences

>Glyma19g31230.1   sequence type=predicted peptide   gene model=Glyma19g31230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEIFPIPAESYTLGFIGAGKMAESIARGAVRSGVLPPSRIRTAVHFNLARRGAFESFGVTVLPSNDDVVRESDVVVLSVKPQLVKDVVSKLTPLLTKNKLLVSVAAGTKLKDLQEWAGNDRFIRVMPNTPAAVGQAASVMSLGGSATEEDGNIIAQLFGSIGKIWKAEEKYFDAITGLSGSGPAYVYLAIEALADGGVAAGLPRDLSLSLASQTVLGAASMVSQTGKHPGQLKDDVTSPGGTTITGIHELENGGFRGTLMNAVVAAAKRSRELS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain